Anti-ENDOD1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ENDOD1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA010517
• Supplier Catalog Number: HPA010517
• Alternative Catalog Number: ATA-HPA010517-25,ATA-HPA010517-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: KIAA0830

Product Description

endonuclease domain containing 1

Additional Information

Anti-ENDOD1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 23052
• UniProt: O94919
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GECDKFFYAGTPPAGLAADSHVKICQRAEGAERFATLYSTRDRIPVYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSF
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ENDOD1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human prostate and pancreas tissues using Anti-ENDOD1 antibody. Corresponding ENDOD1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, liver, pancreas and prostate using Anti-ENDOD1 antibody HPA010517 (A) shows similar protein distribution across tissues to independent antibody HPA008932 (B).

Immunohistochemical staining of human prostate shows high expression.

Immunohistochemical staining of human pancreas shows low expression as expected.

Immunohistochemical staining of human liver using Anti-ENDOD1 antibody HPA010517.

Immunohistochemical staining of human cerebral cortex using Anti-ENDOD1 antibody HPA010517.

HPA010517

HPA010517

HPA010517