Anti-CD74, Rabbit, Polyclonal
Catalog Number:
ATA-HPA010592
- Images (9)
| Article Name: | Anti-CD74, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA010592 |
| Supplier Catalog Number: | HPA010592 |
| Alternative Catalog Number: | ATA-HPA010592-25,ATA-HPA010592-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DHLAG |
| CD74 molecule, major histocompatibility complex, class II invariant chain |
| Anti-CD74 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 972 |
| UniProt: | P04233 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PKPVSKMRMATPLLMQALPMGALPQGPMQTKYGNMTEDHVMHLLQDPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD74 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows strong membranous and cytoplasmic positivity in germinal center cells and in non-germinal center cells. |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
Western blot analysis in human cell line Daudi. |
|
|
HPA010592 |
|
|
|
|
|
HPA010592 |
|
|
HPA010592 |
Product Guarantee and Expert Support
