Anti-ALK, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ALK, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA010694
• Supplier Catalog Number: HPA010694
• Alternative Catalog Number: ATA-HPA010694-25,ATA-HPA010694-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD246, Pan-Cancer

Product Description

anaplastic lymphoma receptor tyrosine kinase

Additional Information

Anti-ALK

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 238
• UniProt: Q9UM73
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ALK
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50

Images

Immunofluorescent staining of human cell line RH-30 shows localization to plasma membrane.

Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neurons.

HPA010694

HPA010694