Anti-ADAM17, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ADAM17, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA010738
• Supplier Catalog Number: HPA010738
• Alternative Catalog Number: ATA-HPA010738-25,ATA-HPA010738-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD156B, cSVP, TACE, Pan-Cancer

Product Description

ADAM metallopeptidase domain 17

Additional Information

Anti-ADAM17

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 6868
• UniProt: P78536
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ADAM17
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.

Immunohistochemical staining of human small intestine shows membranous and cytoplasmic positivity.

HPA010738

HPA010738

HPA010738