Anti-DPYSL3, Rabbit, Polyclonal
Catalog Number:
ATA-HPA010948
- Images (9)
| Article Name: | Anti-DPYSL3, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA010948 |
| Supplier Catalog Number: | HPA010948 |
| Alternative Catalog Number: | ATA-HPA010948-25,ATA-HPA010948-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CRMP4, DRP-3, ULIP |
| dihydropyrimidinase-like 3 |
| Anti-DPYSL3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1809 |
| UniProt: | Q14195 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DPYSL3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells. |
|
|
Western blot analysis in human cell line NTERA-2. |
|
|
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12. |
|
|
|
|
|
|
|
|
HPA010948 |
|
|
HPA010948 |
|
|
HPA010948 |
Product Guarantee and Expert Support
