Anti-C1GALT1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA011294
- Images (9)
| Article Name: | Anti-C1GALT1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA011294 |
| Supplier Catalog Number: | HPA011294 |
| Alternative Catalog Number: | ATA-HPA011294-25,ATA-HPA011294-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1GALT, T-synthase |
| core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 |
| Anti-C1GALT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 56913 |
| UniProt: | Q9NS00 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VDTQPNVLHNDPHARHSDDNGQNHLEGQMNFDSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C1GALT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, liver and parathyroid gland using Anti-C1GALT1 antibody HPA011294 (A) shows similar protein distribution across tissues to independent antibody HPA012819 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-C1GALT1 antibody HPA011294. |
|
|
Immunohistochemical staining of human liver using Anti-C1GALT1 antibody HPA011294. |
|
|
Immunohistochemical staining of human parathyroid gland using Anti-C1GALT1 antibody HPA011294. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-C1GALT1 antibody HPA011294. |
|
|
Western blot analysis in human cell lines U2OS and HEK293 using Anti-C1GALT1 antibody. Corresponding C1GALT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
HPA011294 |
|
|
HPA011294 |
|
|
HPA011294 |
Product Guarantee and Expert Support
