Anti-ENG, Rabbit, Polyclonal
Catalog Number:
ATA-HPA011862
| Article Name: |
Anti-ENG, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA011862 |
| Supplier Catalog Number: |
HPA011862 |
| Alternative Catalog Number: |
ATA-HPA011862-25,ATA-HPA011862-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CD105, END, HHT1, ORW, ORW1, Pan-Cancer |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
2022 |
| UniProt: |
P17813 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
ENG |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
![]()
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells. |
![]()
|
Western blot analysis in human cell line U-138 MG. |
![]()
|
HPA011862 |
![]()
|
HPA011862 |
