Anti-CSF1R Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CSF1R Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA012323
• Supplier Catalog Number: HPA012323
• Alternative Catalog Number: ATA-HPA012323-100,ATA-HPA012323-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: C-FMS, CD115, CSFR, FMS

Product Description

colony stimulating factor 1 receptor

Additional Information

Anti-CSF1R

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 1436
• UniProt: P07333
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CSF1R
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & vesicles.

Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in non - germinal center cells.

Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Western blot analysis in human cell line BEWO.

Western blot analysis in control (vector only transfected HEK293T lysate) and CSF1R over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401594).

HPA012323

HPA012323

HPA012323