Anti-APC, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-APC, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA013349
• Supplier Catalog Number: HPA013349
• Alternative Catalog Number: ATA-HPA013349-25,ATA-HPA013349-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DP2, DP2.5, DP3, PPP1R46, Pan-Cancer

Product Description

adenomatous polyposis coli

Additional Information

Anti-APC

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 324
• UniProt: P25054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: APC
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemical staining of human small intestine shows moderate to strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.

Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected.

Immunohistochemical staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

HPA013349

HPA013349

HPA013349