Anti-MS4A1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MS4A1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA014391
• Supplier Catalog Number: HPA014391
• Alternative Catalog Number: ATA-HPA014391-25,ATA-HPA014391-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: B1, Bp35, CD20, MS4A2, Pan-Cancer

Product Description

membrane-spanning 4-domains, subfamily A, member 1

Additional Information

Anti-MS4A1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 931
• UniProt: P11836
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MS4A1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using Anti-MS4A1 antibody. Corresponding MS4A1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, lymph node, spleen and testis using Anti-MS4A1 antibody HPA014391 (A) shows similar protein distribution across tissues to independent antibody HPA014341 (B).

Immunohistochemical staining of human cerebral cortex shows low expression as expected.

Immunohistochemical staining of human tonsil shows high expression.

Immunohistochemical staining of human spleen using Anti-MS4A1 antibody HPA014391.

Immunohistochemical staining of human testis using Anti-MS4A1 antibody HPA014391.

Immunohistochemical staining of human lymph node using Anti-MS4A1 antibody HPA014391.

HPA014391

HPA014391

HPA014391