Anti-SIGMAR1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA018002
- Images (9)
| Article Name: | Anti-SIGMAR1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA018002 |
| Supplier Catalog Number: | HPA018002 |
| Alternative Catalog Number: | ATA-HPA018002-25,ATA-HPA018002-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | OPRS1, SR-BP1 |
| sigma non-opioid intracellular receptor 1 |
| Anti-SIGMAR1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10280 |
| UniProt: | Q99720 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVGG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SIGMAR1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human Fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic and membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell lines PC-3 and MCF-7 using Anti-SIGMAR1 antibody. Corresponding SIGMAR1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
HPA018002 |
|
|
|
|
|
HPA018002 |
|
|
HPA018002 |
Product Guarantee and Expert Support
