Anti-RUVBL1 Antibody 100ul, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA019947
- Images (14)
| Article Name: | Anti-RUVBL1 Antibody 100ul, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA019947 |
| Supplier Catalog Number: | HPA019947 |
| Alternative Catalog Number: | ATA-HPA019947-100,ATA-HPA019947-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a |
| RuvB-like AAA ATPase 1 |
| Anti-RUVBL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 8607 |
| UniProt: | Q9Y265 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RUVBL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-RUVBL1 antibody. Corresponding RUVBL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-RUVBL1 antibody HPA019947 (A) shows similar protein distribution across tissues to independent antibody HPA019948 (B). |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-RUVBL1 antibody HPA019947. |
|
|
Immunohistochemical staining of human lymph node using Anti-RUVBL1 antibody HPA019947. |
|
|
Immunohistochemical staining of human kidney using Anti-RUVBL1 antibody HPA019947. |
|
|
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RUVBL1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
HPA019947 |
|
|
|
|
|
|
|
|
HPA019947 |
|
|
HPA019947 |
Product Guarantee and Expert Support
