Anti-RUVBL1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA019947
Article Name: Anti-RUVBL1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA019947
Supplier Catalog Number: HPA019947
Alternative Catalog Number: ATA-HPA019947-100,ATA-HPA019947-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a
RuvB-like AAA ATPase 1
Anti-RUVBL1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 8607
UniProt: Q9Y265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RUVBL1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-RUVBL1 antibody. Corresponding RUVBL1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-RUVBL1 antibody HPA019947 (A) shows similar protein distribution across tissues to independent antibody HPA019948 (B).
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human testis using Anti-RUVBL1 antibody HPA019947.
Immunohistochemical staining of human lymph node using Anti-RUVBL1 antibody HPA019947.
Immunohistochemical staining of human kidney using Anti-RUVBL1 antibody HPA019947.
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RUVBL1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
HPA019947
HPA019947
HPA019947