Anti-LRP1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LRP1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA022903
• Supplier Catalog Number: HPA022903
• Alternative Catalog Number: ATA-HPA022903-25,ATA-HPA022903-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: A2MR, APR, CD91, LRP, Pan-Cancer

Product Description

low density lipoprotein receptor-related protein 1

Additional Information

Anti-LRP1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 4035
• UniProt: Q07954
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: LRP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human placenta and pancreas tissues using HPA022903 antibody. Corresponding LRP1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.

Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in stromal cells.

Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Western blot analysis in human cell line RH-30.

HPA022903

HPA022903

HPA022903