Anti-AFP, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-AFP, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA023600
• Supplier Catalog Number: HPA023600
• Alternative Catalog Number: ATA-HPA023600-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FETA, HPAFP, Pan-Cancer

Product Description

alpha-fetoprotein

Additional Information

Anti-AFP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 174
• UniProt: P02771
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQFLVA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: AFP
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human stomach shows distinct cytoplasmic positivity in glandular cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

HPA023600

HPA023600

HPA023600