Anti-HDAC6, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-HDAC6, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA026321
• Supplier Catalog Number: HPA026321
• Alternative Catalog Number: ATA-HPA026321-25,ATA-HPA026321-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ16239, HD6, JM21, KIAA0901, PPP1R90, Pan-Cancer

Product Description

histone deacetylase 6

Additional Information

Anti-HDAC6

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 10013
• UniProt: Q9UBN7
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: HDAC6
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

HPA026321

HPA026321

HPA026321