Anti-FAS, Rabbit, Polyclonal
Catalog Number:
ATA-HPA027444
- Images (10)
| Article Name: | Anti-FAS, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA027444 |
| Supplier Catalog Number: | HPA027444 |
| Alternative Catalog Number: | ATA-HPA027444-25,ATA-HPA027444-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | APO-1, APT1, CD95, FAS1, TNFRSF6, Pan-Cancer |
| Fas cell surface death receptor |
| Anti-FAS |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 355 |
| UniProt: | P25445 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FAS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & cytosol. |
|
|
Immunohistochemistry analysis in human rectum and skeletal muscle tissues using Anti-FAS antibody. Corresponding FAS RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human rectum shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell line HDLM-2. |
|
|
HPA027444 |
|
|
|
|
|
|
|
|
HPA027444 |
|
|
HPA027444 |
Product Guarantee and Expert Support
