Anti-ADAMTS20, Rabbit, Polyclonal

Catalog Number: ATA-HPA027608
Article Name: Anti-ADAMTS20, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA027608
Supplier Catalog Number: HPA027608
Alternative Catalog Number: ATA-HPA027608-25,ATA-HPA027608-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GON-1
ADAM metallopeptidase with thrombospondin type 1 motif, 20
Clonality: Polyclonal
Isotype: IgG
NCBI: 80070
UniProt: P59510
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DWSPCSASCGHGKTTRQVLCMNYHQPIDENYCDPEVRPLMEQECSLAACPPAHSHFPSSPVQPSYYLSTNLPLTQKLEDNENQVVHPSVRGNQWRTG
Target: ADAMTS20
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
HPA027608