Anti-ADAMTS20, Rabbit, Polyclonal
Catalog Number:
ATA-HPA027608
Article Name: |
Anti-ADAMTS20, Rabbit, Polyclonal |
Biozol Catalog Number: |
ATA-HPA027608 |
Supplier Catalog Number: |
HPA027608 |
Alternative Catalog Number: |
ATA-HPA027608-25,ATA-HPA027608-100 |
Manufacturer: |
Atlas Antibodies |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC |
Species Reactivity: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Conjugation: |
Unconjugated |
Alternative Names: |
GON-1 |
ADAM metallopeptidase with thrombospondin type 1 motif, 20 |
Clonality: |
Polyclonal |
Isotype: |
IgG |
NCBI: |
80070 |
UniProt: |
P59510 |
Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequence: |
DWSPCSASCGHGKTTRQVLCMNYHQPIDENYCDPEVRPLMEQECSLAACPPAHSHFPSSPVQPSYYLSTNLPLTQKLEDNENQVVHPSVRGNQWRTG |
Target: |
ADAMTS20 |
Antibody Type: |
Monoclonal Antibody |
Application Dilute: |
IHC: 1:20 - 1:50 |
|
HPA027608 |