Anti-NFKBIA, Rabbit, Polyclonal
Catalog Number:
ATA-HPA029207
- Images (6)
| Article Name: | Anti-NFKBIA, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA029207 |
| Supplier Catalog Number: | HPA029207 |
| Alternative Catalog Number: | ATA-HPA029207-25,ATA-HPA029207-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IkappaBalpha, IKBA, MAD-3, NFKBI, Pan-Cancer |
| nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha |
| Anti-NFKBIA |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4792 |
| UniProt: | P25963 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NFKBIA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human appendix shows moderate cytoplasmic positivity in lymphoid cells and glandular cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA029207 |
|
|
HPA029207 |
|
|
HPA029207 |
Product Guarantee and Expert Support
