Anti-E2F1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-E2F1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA029735
• Supplier Catalog Number: HPA029735
• Alternative Catalog Number: ATA-HPA029735-25,ATA-HPA029735-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: RBBP3, RBP3, Pan-Cancer

Product Description

E2F transcription factor 1

Additional Information

Anti-E2F1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 1869
• UniProt: Q01094
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: E2F1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line RH-30 shows localization to centrosome.

Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

HPA029735

HPA029735