Anti-PCNA, Rabbit, Polyclonal
Catalog Number:
ATA-HPA030522
- Images (19)
| Article Name: | Anti-PCNA, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA030522 |
| Supplier Catalog Number: | HPA030522 |
| Alternative Catalog Number: | ATA-HPA030522-25,ATA-HPA030522-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| proliferating cell nuclear antigen |
| Anti-PCNA |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5111 |
| UniProt: | P12004 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KCAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PCNA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies. |
|
|
Immunohistochemistry analysis in human small intestine and skeletal muscle tissues using HPA030522 antibody. Corresponding PCNA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow, kidney, lymph node and testis using Anti-PCNA antibody HPA030522 (A) shows similar protein distribution across tissues to independent antibody HPA030521 (B). |
|
|
Immunohistochemical staining of human liver shows moderate to strong nuclear positivity in hepatocytes. |
|
|
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in epidermal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak nuclear positivity in myocytes. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney using Anti-PCNA antibody HPA030522. |
|
|
Immunohistochemical staining of human bone marrow using Anti-PCNA antibody HPA030522. |
|
|
Immunohistochemical staining of human testis using Anti-PCNA antibody HPA030522. |
|
|
Immunohistochemical staining of human lymph node using Anti-PCNA antibody HPA030522. |
|
|
Western blot analysis using Anti-PCNA antibody HPA030522 (A) shows similar pattern to independent antibody HPA030521 (B). |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA030522 |
|
|
|
|
|
|
|
|
HPA030522 |
|
|
HPA030522 |
Product Guarantee and Expert Support
