Anti-CCNB1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CCNB1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA030741
• Supplier Catalog Number: HPA030741
• Alternative Catalog Number: ATA-HPA030741-25,ATA-HPA030741-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CCNB, Pan-Cancer

Product Description

cyclin B1

Additional Information

Anti-CCNB1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 891
• UniProt: P14635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGAD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CCNB1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CCNB1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

HPA030741

HPA030741