Anti-SRC, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SRC, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA030875
• Supplier Catalog Number: HPA030875
• Alternative Catalog Number: ATA-HPA030875-25,ATA-HPA030875-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ASV, c-src, SRC1, Pan-Cancer

Product Description

SRC proto-oncogene, non-receptor tyrosine kinase

Additional Information

Anti-SRC

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 6714
• UniProt: P12931
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SRC
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol.

Immunohistochemical staining of human testis shows membranous and cytoplasmic positivity in cells in seminferous ducts.

Western blot analysis in human cell lines A-549 and HeLa using Anti-SRC antibody. Corresponding SRC RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

HPA030875

HPA030875