Anti-ADAMTS5, Rabbit, Polyclonal

Catalog Number: ATA-HPA030908
Article Name: Anti-ADAMTS5, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA030908
Supplier Catalog Number: HPA030908
Alternative Catalog Number: ATA-HPA030908-25,ATA-HPA030908-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADAMTS11, ADMP-2
ADAM metallopeptidase with thrombospondin type 1 motif, 5
Clonality: Polyclonal
Isotype: IgG
NCBI: 11096
UniProt: Q9UNA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQ
Target: ADAMTS5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml
HPA030908