Anti-ITGA2B, Rabbit, Polyclonal
Catalog Number:
ATA-HPA031171
- Images (10)
| Article Name: | Anti-ITGA2B, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA031171 |
| Supplier Catalog Number: | HPA031171 |
| Alternative Catalog Number: | ATA-HPA031171-25,ATA-HPA031171-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD41, CD41B, GP2B, PPP1R93, Pan-Cancer |
| integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) |
| Anti-ITGA2B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3674 |
| UniProt: | P08514 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ITGA2B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human bone marrow and stomach tissues using Anti-ITGA2B antibody. Corresponding ITGA2B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow, colon, liver and lymph node using Anti-ITGA2B antibody HPA031171 (A) shows similar protein distribution across tissues to independent antibody HPA031168 (B). |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human stomach shows low expression as expected. |
|
|
Immunohistochemical staining of human colon using Anti-ITGA2B antibody HPA031171. |
|
|
Immunohistochemical staining of human liver using Anti-ITGA2B antibody HPA031171. |
|
|
Immunohistochemical staining of human lymph node using Anti-ITGA2B antibody HPA031171. |
|
|
HPA031171 |
|
|
HPA031171 |
|
|
HPA031171 |
Product Guarantee and Expert Support
