Anti-EPAS1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA031200
Article Name: |
Anti-EPAS1, Rabbit, Polyclonal |
Biozol Catalog Number: |
ATA-HPA031200 |
Supplier Catalog Number: |
HPA031200 |
Alternative Catalog Number: |
ATA-HPA031200-25,ATA-HPA031200-100 |
Manufacturer: |
Atlas Antibodies |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ICC |
Species Reactivity: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Conjugation: |
Unconjugated |
Alternative Names: |
bHLHe73, HIF2A, HLF, MOP2, PASD2, Pan-Cancer |
endothelial PAS domain protein 1 |
Clonality: |
Polyclonal |
Concentration: |
0.2 mg/ml |
Isotype: |
IgG |
NCBI: |
2034 |
UniProt: |
Q99814 |
Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequence: |
GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG |
Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target: |
EPAS1 |
Antibody Type: |
Monoclonal Antibody |
Application Dilute: |
ICC-IF: 0.25-2 µg/ml |
|
Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & cytosol. |
|
HPA031200 |