Anti-PTEN Antibody 100ul, Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA031335
Article Name: Anti-PTEN Antibody 100ul, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA031335
Supplier Catalog Number: HPA031335
Alternative Catalog Number: ATA-HPA031335-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BZS, MHAM, MMAC1, PTEN1, TEP1
phosphatase and tensin homolog
Anti-PTEN
Clonality: Polyclonal
Isotype: IgG
NCBI: 5728
UniProt: P60484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PTEN
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Western blot analysis in human cell line A-431.
HPA031335
HPA031335
HPA031335