Anti-PTEN, Rabbit, Polyclonal
Catalog Number:
ATA-HPA031335
- Images (5)
| Article Name: | Anti-PTEN, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA031335 |
| Supplier Catalog Number: | HPA031335 |
| Alternative Catalog Number: | ATA-HPA031335-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BZS, MHAM, MMAC1, PTEN1, TEP1, Pan-Cancer |
| phosphatase and tensin homolog |
| Anti-PTEN |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 5728 |
| UniProt: | P60484 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PTEN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. |
|
|
Western blot analysis in human cell line A-431. |
|
|
HPA031335 |
|
|
HPA031335 |
|
|
HPA031335 |
Product Guarantee and Expert Support
