Anti-PTEN Antibody 100ul, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PTEN Antibody 100ul, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA031335
• Supplier Catalog Number: HPA031335
• Alternative Catalog Number: ATA-HPA031335-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: BZS, MHAM, MMAC1, PTEN1, TEP1

Product Description

phosphatase and tensin homolog

Additional Information

Anti-PTEN

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 5728
• UniProt: P60484
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PTEN
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.

Western blot analysis in human cell line A-431.

HPA031335

HPA031335

HPA031335