Anti-TMPRSS2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA035787
- Images (8)
| Article Name: | Anti-TMPRSS2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA035787 |
| Supplier Catalog Number: | HPA035787 |
| Alternative Catalog Number: | ATA-HPA035787-25,ATA-HPA035787-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PRSS10 |
| transmembrane protease, serine 2 |
Anti-TMPRSS2 TMPRSS2 The serine protease TMPRSS is a co-receptor for SARS-Cov-2 together with ACE2 (Lucassen et al. 2020 in press) and primes the viral spike protein of SARS-Cov-2 (Hoffmann et al. 2020). TMRSS binds the same transient bronchial secretory cell type as ACE2 (Lucassen et al. 2020 in press). References: Hoffmann M et al. (2020), SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 181, Issue 2, 1271-280.e8 Lukassen S. et al. (2020), SARS‐CoV‐2 receptor ACE2 and TMPRSS2 are primarily expressed in bronchial transient secretory cells. EMBO J (2020)e105114https://doi.org/10.15252/embj.20105114 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 7113 |
| UniProt: | O15393 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMPRSS2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human prostate and endometrium tissues using Anti-TMPRSS2 antibody. Corresponding TMPRSS2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and TMPRSS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401727). |
|
|
HPA035787 |
|
|
|
|
|
HPA035787 |
|
|
HPA035787 |
Product Guarantee and Expert Support
