Anti-CD34, Rabbit, Polyclonal
Catalog Number:
ATA-HPA036722
- Images (9)
| Article Name: | Anti-CD34, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA036722 |
| Supplier Catalog Number: | HPA036722 |
| Alternative Catalog Number: | ATA-HPA036722-25,ATA-HPA036722-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| CD34 molecule |
| Anti-CD34 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 947 |
| UniProt: | P28906 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD34 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human placenta and tonsil tissues using HPA036722 antibody. Corresponding CD34 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human tonsil shows moderate to strong membranous positivity in endothelial cells. |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
HPA036722 |
|
|
HPA036722 |
|
|
HPA036722 |
Product Guarantee and Expert Support
