Anti-CD34, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CD34, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA036723
• Supplier Catalog Number: HPA036723
• Alternative Catalog Number: ATA-HPA036723-25,ATA-HPA036723-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Pan-Cancer

Product Description

CD34 molecule

Additional Information

Anti-CD34

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 947
• UniProt: P28906
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CD34
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cell junctions.

Immunohistochemistry analysis in human placenta and cerebral cortex tissues using HPA036723 antibody. Corresponding CD34 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human lymphoid tissues shows moderate to strong membranous positivity in endothelial cells.

Immunohistochemical staining of human kidney shows moderate membranous positivity in endothelial cells.

Immunohistochemical staining of human cerebral cortex shows moderate membranous positivity in endothelial cells and very weak cytoplasmic positivity in neurons.

Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in endothelial cells.

HPA036723

HPA036723

HPA036723