Anti-CD8A, Rabbit, Polyclonal
Catalog Number:
ATA-HPA037756
- Images (8)
| Article Name: | Anti-CD8A, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA037756 |
| Supplier Catalog Number: | HPA037756 |
| Alternative Catalog Number: | ATA-HPA037756-25,ATA-HPA037756-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD8, Pan-Cancer |
| CD8a molecule |
Anti-CD8A
|
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 925 |
| UniProt: | P01732 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD8A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA037756 antibody. Corresponding CD8A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows moderate to strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity as expected. |
|
|
HPA037756 |
|
|
HPA037756 |
|
|
HPA037756 |
Product Guarantee and Expert Support
