Anti-ADAMTS10, Rabbit, Polyclonal
Catalog Number:
ATA-HPA040223
| Article Name: |
Anti-ADAMTS10, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA040223 |
| Supplier Catalog Number: |
HPA040223 |
| Alternative Catalog Number: |
ATA-HPA040223-25,ATA-HPA040223-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ADAM-TS10 |
| ADAM metallopeptidase with thrombospondin type 1 motif, 10 |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
81794 |
| UniProt: |
Q9H324 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
SLIVMVLARTELPALRYRFPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK |
| Target: |
ADAMTS10 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:20 - 1:50 |
![]()
|
HPA040223 |
