Anti-CLCF1 Antibody 100ul, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CLCF1 Antibody 100ul, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA042444
• Supplier Catalog Number: HPA042444
• Alternative Catalog Number: ATA-HPA042444-100, ATA-HPA042444-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6

Product Properties

• Clonality: Polyclonal
• NCBI: 23529
• UniProt: Q9UBD9
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE
• Target: CLCF1