Anti-IRAK3 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-IRAK3 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA043097
• Supplier Catalog Number: HPA043097
• Alternative Catalog Number: ATA-HPA043097-100,ATA-HPA043097-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: IRAK-M

Product Description

interleukin-1 receptor-associated kinase 3

Additional Information

Anti-IRAK3

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 11213
• UniProt: Q9Y616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SWLDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: IRAK3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line SiHa shows localization to vesicles.

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal and non germinal center cells.

Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected.

Immunohistochemical staining of human gastrointestinal shows strong cytoplasmic positivity in peripheral leukocytes.

Western blot analysis in control (vector only transfected HEK293T lysate) and IRAK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402105).

HPA043097

HPA043097

HPA043097