Anti-CD5, Rabbit, Polyclonal

Catalog Number: ATA-HPA043416
Article Name: Anti-CD5, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA043416
Supplier Catalog Number: HPA043416
Alternative Catalog Number: ATA-HPA043416-25,ATA-HPA043416-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LEU1, T1, Pan-Cancer
CD5 molecule
Anti-CD5
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 921
UniProt: P06127
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDLGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CD5
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-CD5 antibody. Corresponding CD5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
HPA043416
HPA043416
HPA043416