Anti-CHEK1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CHEK1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA044364
• Supplier Catalog Number: HPA044364
• Alternative Catalog Number: ATA-HPA044364-25,ATA-HPA044364-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CHK1, Pan-Cancer

Product Description

checkpoint kinase 1

Additional Information

Anti-CHEK1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1111
• UniProt: O14757
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CHEK1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml

Images

Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.

HPA044364