Anti-ADAMTS7, Rabbit, Polyclonal
Catalog Number:
ATA-HPA045284
Article Name: |
Anti-ADAMTS7, Rabbit, Polyclonal |
Biozol Catalog Number: |
ATA-HPA045284 |
Supplier Catalog Number: |
HPA045284 |
Alternative Catalog Number: |
ATA-HPA045284-25,ATA-HPA045284-100 |
Manufacturer: |
Atlas Antibodies |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC |
Species Reactivity: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Conjugation: |
Unconjugated |
Alternative Names: |
ADAM-TS7, DKFZp434H204 |
ADAM metallopeptidase with thrombospondin type 1 motif, 7 |
Clonality: |
Polyclonal |
Isotype: |
IgG |
NCBI: |
11173 |
UniProt: |
Q9UKP4 |
Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequence: |
LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN |
Target: |
ADAMTS7 |
Antibody Type: |
Monoclonal Antibody |
Application Dilute: |
IHC: 1:50 - 1:200 |
|
HPA045284 |