Anti-ADAMTS7, Rabbit, Polyclonal
Catalog Number:
ATA-HPA045284
| Article Name: |
Anti-ADAMTS7, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA045284 |
| Supplier Catalog Number: |
HPA045284 |
| Alternative Catalog Number: |
ATA-HPA045284-25,ATA-HPA045284-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ADAM-TS7, DKFZp434H204 |
| ADAM metallopeptidase with thrombospondin type 1 motif, 7 |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
11173 |
| UniProt: |
Q9UKP4 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN |
| Target: |
ADAMTS7 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:50 - 1:200 |
![]()
|
HPA045284 |
