Anti-ERBB3, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ERBB3, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA045396
• Supplier Catalog Number: HPA045396
• Alternative Catalog Number: ATA-HPA045396-25,ATA-HPA045396-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: HER3, LCCS2, Pan-Cancer

Product Description

v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3

Additional Information

Anti-ERBB3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 2065
• UniProt: P21860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ERBB3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

Western blot analysis in human cell line SK-MEL-30.

HPA045396

HPA045396