Anti-CDKN2A, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CDKN2A, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA047838
• Supplier Catalog Number: HPA047838
• Alternative Catalog Number: ATA-HPA047838-25,ATA-HPA047838-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ARF, CDK4I, CDKN2, CMM2, INK4, INK4a, MLM, MTS1, p14, p14ARF, p16, p16INK4a, p19, p19Arf, Pan-Cancer

Product Description

cyclin-dependent kinase inhibitor 2A

Additional Information

Anti-CDKN2A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1029
• UniProt: Q8N726
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CDKN2A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml

Images

Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.

HPA047838