Anti-PTH, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PTH, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA048540
• Supplier Catalog Number: HPA048540
• Alternative Catalog Number: ATA-HPA048540-25,ATA-HPA048540-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: PTH1, Pan-Cancer

Product Description

parathyroid hormone

Additional Information

Anti-PTH

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 5741
• UniProt: P01270
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PTH
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500

Images

Immunohistochemistry analysis in human parathyroid gland and cervix, uterine tissues using Anti-PTH antibody. Corresponding PTH RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human parathyroid gland shows high expression.

Immunohistochemical staining of human cervix, uterine shows low expression as expected.

HPA048540

HPA048540

HPA048540