Anti-TLR4, Rabbit, Polyclonal
Catalog Number:
ATA-HPA049174
- Images (4)
| Article Name: | Anti-TLR4, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA049174 |
| Supplier Catalog Number: | HPA049174 |
| Alternative Catalog Number: | ATA-HPA049174-25,ATA-HPA049174-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ARMD10, CD284, hToll, TLR-4, Pan-Cancer |
| toll-like receptor 4 |
| Anti-TLR4 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 7099 |
| UniProt: | O00206 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TLR4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human spleen shows distinct cytoplasmic positivity in subsets of cells in the red pulp. |
|
|
HPA049174 |
|
|
HPA049174 |
|
|
HPA049174 |
Product Guarantee and Expert Support
