Anti-CD80, Rabbit, Polyclonal
Catalog Number:
ATA-HPA050092
- Images (6)
| Article Name: | Anti-CD80, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA050092 |
| Supplier Catalog Number: | HPA050092 |
| Alternative Catalog Number: | ATA-HPA050092-25,ATA-HPA050092-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | B7-1, B7.1, CD28LG, CD28LG1, Pan-Cancer |
| CD80 molecule |
| Anti-CD80 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 941 |
| UniProt: | P33681 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD80 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human tonsil and pancreas tissues using Anti-CD80 antibody. Corresponding CD80 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA050092 |
|
|
HPA050092 |
|
|
HPA050092 |
Product Guarantee and Expert Support
