Anti-IRAK2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-IRAK2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA050520
• Supplier Catalog Number: HPA050520
• Alternative Catalog Number: ATA-HPA050520-100,ATA-HPA050520-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: IRAK2

Product Description

interleukin-1 receptor-associated kinase 2

Additional Information

Anti-IRAK2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 3656
• UniProt: O43187
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: IRAK2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

HPA050520

HPA050520