Anti-PLAUR, Rabbit, Polyclonal
Catalog Number:
ATA-HPA050843
- Images (7)
| Article Name: | Anti-PLAUR, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA050843 |
| Supplier Catalog Number: | HPA050843 |
| Alternative Catalog Number: | ATA-HPA050843-25,ATA-HPA050843-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD87, UPAR, URKR, Pan-Cancer |
| plasminogen activator, urokinase receptor |
| Anti-PLAUR |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5329 |
| UniProt: | Q03405 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLAUR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells. |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity as expected. |
|
|
HPA050843 |
|
|
HPA050843 |
|
|
HPA050843 |
Product Guarantee and Expert Support
