Anti-ADAMTS4, Rabbit, Polyclonal
Catalog Number:
ATA-HPA051296
| Article Name: |
Anti-ADAMTS4, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA051296 |
| Supplier Catalog Number: |
HPA051296 |
| Alternative Catalog Number: |
ATA-HPA051296-25,ATA-HPA051296-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ADAMTS-2, ADMP-1, KIAA0688 |
| ADAM metallopeptidase with thrombospondin type 1 motif, 4 |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
9507 |
| UniProt: |
O75173 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN |
| Target: |
ADAMTS4 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
HPA051296 |
