Anti-CD163, Rabbit, Polyclonal
Catalog Number:
ATA-HPA051974
- Images (10)
| Article Name: | Anti-CD163, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA051974 |
| Supplier Catalog Number: | HPA051974 |
| Alternative Catalog Number: | ATA-HPA051974-25,ATA-HPA051974-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | M130, MM130, Pan-Cancer |
| CD163 molecule |
| Anti-CD163 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 9332 |
| UniProt: | Q86VB7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ACKQLGCPTAVTAIGRVSKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD163 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA051974 antibody. Corresponding CD163 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human gastrointestinal, liver, placenta and spleen using Anti-CD163 antibody HPA051974 (A) shows similar protein distribution across tissues to independent antibody HPA046404 (B). |
|
|
Immunohistochemical staining of human skeletal muscle shows low positivity as expected. |
|
|
Immunohistochemical staining of human spleen shows strong membranous positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human liver shows strong membranous positivity in Kupffer cells. |
|
|
HPA051974 |
|
|
HPA051974 |
|
|
HPA051974 |
Product Guarantee and Expert Support
