Anti-MAP1LC3A, Rabbit, Polyclonal
Catalog Number:
ATA-HPA052474
| Article Name: |
Anti-MAP1LC3A, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA052474 |
| Supplier Catalog Number: |
HPA052474 |
| Alternative Catalog Number: |
ATA-HPA052474-25,ATA-HPA052474-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3, Pan-Cancer |
| microtubule-associated protein 1 light chain 3 alpha |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Isotype: |
IgG |
| NCBI: |
84557 |
| UniProt: |
Q9H492 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
MAP1LC3A |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:200 - 1:500 |
![]()
|
Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in neuronal cells. |
![]()
|
HPA052474 |
