Anti-MME, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MME, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA052583
• Supplier Catalog Number: HPA052583
• Alternative Catalog Number: ATA-HPA052583-25,ATA-HPA052583-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CALLA, CD10, NEP, Pan-Cancer

Product Description

membrane metallo-endopeptidase

Additional Information

Anti-MME

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 4311
• UniProt: P08473
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MME
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:2500 - 1:5000

Images

Immunohistochemistry analysis in human duodenum and cerebral cortex tissues using Anti-MME antibody. Corresponding MME RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, kidney, prostate and small intestine using Anti-MME antibody HPA052583 (A) shows similar protein distribution across tissues to independent antibody HPA056072 (B).

Immunohistochemical staining of human duodenum shows high expression.

Immunohistochemical staining of human cerebral cortex shows low expression as expected.

Immunohistochemical staining of human small intestine using Anti-MME antibody HPA052583.

Immunohistochemical staining of human kidney using Anti-MME antibody HPA052583.

Immunohistochemical staining of human prostate using Anti-MME antibody HPA052583.

HPA052583

HPA052583

HPA052583