Anti-TIMP1, Rabbit, Polyclonal

Catalog Number: ATA-HPA053417
Article Name: Anti-TIMP1, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA053417
Supplier Catalog Number: HPA053417
Alternative Catalog Number: ATA-HPA053417-25,ATA-HPA053417-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLGI, EPO, TIMP, Pan-Cancer
TIMP metallopeptidase inhibitor 1
Anti-TIMP1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 7076
UniProt: P01033
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TIMP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
HPA053417
HPA053417
HPA053417