Anti-IL2RA, Rabbit, Polyclonal
Catalog Number:
ATA-HPA054622
- Images (8)
| Article Name: | Anti-IL2RA, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA054622 |
| Supplier Catalog Number: | HPA054622 |
| Alternative Catalog Number: | ATA-HPA054622-25,ATA-HPA054622-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD25, IDDM10, IL2R, Pan-Cancer |
| interleukin 2 receptor, alpha |
| Anti-IL2RA |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 3559 |
| UniProt: | P01589 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IL2RA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using HPA054622 antibody. Corresponding IL2RA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected. |
|
|
Immunohistochemical staining of human lymph node shows strong membranous positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
HPA054622 |
|
|
HPA054622 |
|
|
HPA054622 |
Product Guarantee and Expert Support
