Anti-MME, Rabbit, Polyclonal
Catalog Number:
ATA-HPA056072
- Images (9)
| Article Name: | Anti-MME, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA056072 |
| Supplier Catalog Number: | HPA056072 |
| Alternative Catalog Number: | ATA-HPA056072-25,ATA-HPA056072-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CALLA, CD10, NEP, Pan-Cancer |
| membrane metallo-endopeptidase |
| Anti-MME |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 4311 |
| UniProt: | P08473 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MME |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human small intestine and cerebral cortex tissues using Anti-MME antibody. Corresponding MME RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, prostate and small intestine using Anti-MME antibody HPA056072 (A) shows similar protein distribution across tissues to independent antibody HPA052583 (B). |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human prostate using Anti-MME antibody HPA056072. |
|
|
Immunohistochemical staining of human kidney using Anti-MME antibody HPA056072. |
|
|
HPA056072 |
|
|
HPA056072 |
|
|
HPA056072 |
Product Guarantee and Expert Support
